Structure of PDB 6qx9 Chain 1C Binding Site BS01

Receptor Information
>6qx9 Chain 1C (length=50) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLID
Ligand information
>6qx9 Chain 1 (length=164) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auacuuaccuggcaggggagauaccaugaucacgaaggugguuuucccag
ggcgaggcuuauccauugcacuccggaugugcugaccccugcgauuuccc
caaaugugggaaacucgacugcauaauuugugguagugggggacugcguu
cgcgcuuuccccug
...........<<<<.<<<<<.<<<<<..........>>>>>>>>>>.<<
<<...<<<.<<<<<..........>>>>>.>>>...>>>>.<<<<<<<<<
.......>>>>>>.>>>.>>>>...............<<<<<<..<<<..
..>>>..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
Resolution3.28 Å
Binding residue
(original residue number in PDB)		P2 K3 H15 S17 S19 V20 K29
Binding residue
(residue number reindexed from 1)		P1 K2 H14 S16 S18 V19 K28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003727 single-stranded RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0030619 U1 snRNA binding
GO:0030627 pre-mRNA 5'-splice site binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0015030 Cajal body
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
PDBsum6qx9
PubMed30975767
UniProtP09234|RU1C_HUMAN U1 small nuclear ribonucleoprotein C (Gene Name=SNRPC)

[Back to BioLiP]