Structure of PDB 8fnk Chain 13 Binding Site BS01

Receptor Information
>8fnk Chain 13 (length=127) Species: 5691 (Trypanosoma brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPWNDGDAGWRGAATGARANRGRGGFRRGRQRVQVSGLSDETTWHTLKDH
LRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLRED
REDTVLVNTRRKIREVRDAQLRARKEE
Ligand information
>8fnk Chain m (length=51) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uauauaauagaauaagauaaguuuuuuuuuuuuuuuuuuuuuuuuuuuuu
u
..................................................
.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fnk Structural basis of gRNA stabilization and mRNA recognition in trypanosomal RNA editing.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
R131 W205
Binding residue
(residue number reindexed from 1)
R23 W44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
Biological Process
GO:0006396 RNA processing
GO:0090615 mitochondrial mRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0020023 kinetoplast
GO:0031019 mitochondrial mRNA editing complex
GO:0032473 cytoplasmic side of mitochondrial outer membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fnk, PDBe:8fnk, PDBj:8fnk
PDBsum8fnk
PubMed37410820
UniProtQ389P7

[Back to BioLiP]