Structure of PDB 7w5a Chain 1 Binding Site BS01

Receptor Information
>7w5a Chain 1 (length=267) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRP
TLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKK
KDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMK
IVEEYAKVDLAKRTLKAQKLIREDIAKYLRNLDPNSAYYDPKTRAMRENP
YANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQAD
PTKLELLYKSFKVKKED
Ligand information
>7w5a Chain G (length=82) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaagagccuagcauguagaacugguuaccuccaggguuuccuugaugau
gucauacuuauccuguacagcucgcgguugag
..................................................
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w5a Mechanism of exon ligation by human spliceosome.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		W33 R34
Binding residue
(residue number reindexed from 1)		W3 R4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000386 second spliceosomal transesterification activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0030628 pre-mRNA 3'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000375 RNA splicing, via transesterification reactions
GO:0000380 alternative mRNA splicing, via spliceosome
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006886 intracellular protein transport
GO:0008380 RNA splicing
GO:0034605 cellular response to heat
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0030532 small nuclear ribonucleoprotein complex
GO:0043231 intracellular membrane-bounded organelle
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w5a, PDBe:7w5a, PDBj:7w5a
PDBsum7w5a
PubMed35705093
UniProtO95391|SLU7_HUMAN Pre-mRNA-splicing factor SLU7 (Gene Name=SLU7)

[Back to BioLiP]