Structure of PDB 7q4o Chain 1 Binding Site BS01

Receptor Information
>7q4o Chain 1 (length=41) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLA
Ligand information
>7q4o Chain 2 (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaguguaguaucuguucuuaucaguuuaauaucug
.....................<<<........>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q4o Structural basis of branch site recognition by the human spliceosome.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T61 L62 S68 A71 H72 G75
Binding residue
(residue number reindexed from 1)		T19 L20 S26 A29 H30 G33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0010976 positive regulation of neuron projection development
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q4o, PDBe:7q4o, PDBj:7q4o
PDBsum7q4o
PubMed34822310
UniProtQ15428|SF3A2_HUMAN Splicing factor 3A subunit 2 (Gene Name=SF3A2)

[Back to BioLiP]