Structure of PDB 7asa Chain 1 Binding Site BS01

Receptor Information
>7asa Chain 1 (length=83) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRLDKFLKVSRLIKRRTLAKEVADQGRISINGNQAKASSDVKPGDELTVR
FGQKLVTVQVNELKDTTKKEEAANMYTILKEEK
Ligand information
>7asa Chain 2 (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uagcucagagagcgccugcuuugcacgcaggagg
..<<<<...>>>>.<<<<<.......>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7asa Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R11 T67 K68 K69
Binding residue
(residue number reindexed from 1)		R11 T67 K68 K69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7asa, PDBe:7asa, PDBj:7asa
PDBsum7asa
PubMed33259810
UniProtP37557|YABO_BACSU Uncharacterized protein YabO (Gene Name=yabO)

[Back to BioLiP]