Structure of PDB 6grh Chain 1 Binding Site BS01

Receptor Information
>6grh Chain 1 (length=284) Species: 511145 (Escherichia coli str. K-12 substr. MG1655) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MINILPFEIISRNTKTLLITYISSVDITHEGMKKVLESLRSKQGIISEYL
LDKLLDESLIDKDKGKEFLITTGVINKTKTSPLWVNSVIISDVPHLFSNA
REQWKCDGVFVSHIIDIKDNNINVSDSTLIWLHLENYHSDIVKRIYSKFE
SNPGVAFIQSYYLKESFRIDGVYSPDLGTPCHFCHIERWLSREEKSFRRN
EMSWANLLQLLKKYQMTLPALALGESERGFSYHLIKRRLQELTGTSLVKS
HVDNFMSSVSADLITCILCKEPVIHWQACSCLER
Ligand information
>6grh Chain A (length=20) Species: 511145 (Escherichia coli str. K-12 substr. MG1655) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KASEFGVVLSVDALKLSRQG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6grh Architecture of Microcin B17 Synthetase: An Octameric Protein Complex Converting a Ribosomally Synthesized Peptide into a DNA Gyrase Poison.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		M12 I33 S34 S35 V36 D37 I38 T39 H40 M43 I71 F79
Binding residue
(residue number reindexed from 1)		M1 I22 S23 S24 V25 D26 I27 T28 H29 M32 I60 F68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0017000 antibiotic biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6grh, PDBe:6grh, PDBj:6grh
PDBsum6grh
PubMed30661981
UniProtP23184|MCBB_ECOLX Microcin B17-processing protein McbB (Gene Name=mcbB)

[Back to BioLiP]