Structure of PDB 5o5p Chain 1 Binding Site BS01

Receptor Information

>5o5p Chain 1 (length=235) Species: 12086 (Poliovirus 3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QRRSRSESTIESFFARGACVAIIEVDNEEPTTRAQKLFAMWRITYKDTVQ
LRRKLEFFTYSRFDMELTFVVTANFTNTNNGHALNQVYQIMYIPPGAPTP
KSWDDYTWQTSSNPSIFYTYGAAPARISVPYVGLANAYSHFYDGFAKVPL
KTDANDQIGDSLYSAMTVDDFGVLAIRVVNDHNPTKVTSKVRIYMKPKHV
RVWCPRPPRAVPYYGPGVDYKDNLNPLSEKGLTTY

Ligand information

>5o5p Chain 4 (length=17) Species: 12086 (Poliovirus 3) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

INYTTINYYKDSASNAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5o5p Plant-made polio type 3 stabilized VLPs-a candidate synthetic polio vaccine.
Resolution	4.1 Å
Binding residue (original residue number in PDB)	D129 K263
Binding residue (residue number reindexed from 1)	D64 K198

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

View graph for
Molecular Function

External links

PDB	RCSB:5o5p, PDBe:5o5p, PDBj:5o5p
PDBsum	5o5p
PubMed	28811473
UniProt	Q84895

[Back to BioLiP]