Structure of PDB 3lk4 Chain 1 Binding Site BS01

Receptor Information
>3lk4 Chain 1 (length=269) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQY
NMDQFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASD
PQPEDTESALKQWRDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIAC
IESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLKIQVHYYEDGNVQLV
SHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKA
LRRQLPVTRTKIDWNKILS
Ligand information
>3lk4 Chain 3 (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VNFDDIASSENLLHLTANRPKMPGRRLPG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lk4 Structural characterization of a capping protein interaction motif defines a family of actin filament regulators.
Resolution1.99 Å
Binding residue
(original residue number in PDB)		N30 E31 F33 N34 R37 R47 L101 R102
Binding residue
(residue number reindexed from 1)		N23 E24 F26 N27 R30 R40 L94 R95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization
GO:0034329 cell junction assembly
GO:0051016 barbed-end actin filament capping
GO:0051693 actin filament capping
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0008290 F-actin capping protein complex
GO:0030018 Z disc
GO:0030863 cortical cytoskeleton
GO:0071203 WASH complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lk4, PDBe:3lk4, PDBj:3lk4
PDBsum3lk4
PubMed20357771
UniProtP13127|CAZA1_CHICK F-actin-capping protein subunit alpha-1 (Gene Name=CAPZA1)

[Back to BioLiP]