Structure of PDB 2wff Chain 1 Binding Site BS01

Receptor Information
>2wff Chain 1 (length=246) Species: 47000 (Equine rhinitis A virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTNVGEDGEPGETEPRHALSPVDMHVHTDVSFLLDRFFDVETLELSNLTG
SPATHVLDPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPSSVGEG
FVWVKWFPVGAPTKTTDAWQLEGGGNSVRIQQLAVAGMSPTVVFKIAGSR
SQACGFSVPYTSMWRVVPVFYNGWGAPTKEKATYNWLPGAHFGSILLTSD
AHDKGGCYLRYRFPRANMYCPRPIPPAFTRPADKTRHKFPTNINKQ
Ligand information
>2wff Chain 4 (length=21) Species: 47000 (Equine rhinitis A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GNSGSIVQNFYMQQYQNSIDA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wff Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
Resolution4.0 Å
Binding residue
(original residue number in PDB)		D35 D81 R215
Binding residue
(residue number reindexed from 1)		D35 D81 R215
Enzymatic activity
Enzyme Commision number ?
External links