Structure of PDB 1gtj Chain 1 Binding Site BS01

Receptor Information

>1gtj Chain 1 (length=357) Species: 198803 (Bacillus sp. MN-32) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AAPTAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDETSLAQYFASLG
VSAPQVVSVSVDGATNQPTGDPNGPDGEVELDIEVAGALAPGAKIAVYFA
PNTDAGFLNAITTAVHDPTHKPSIVSISWGGPEDSWAPASIAAMNRAFLD
AAALGVTVLAAAGDSGSTDGEQDGLYHVDFPAASPYVLACGGTRLVASAG
RIERETVWNDGPDGGSTGGGVSRIFPLPSWQERANVPPSANPGAGSGRGV
PDVAGNADPATGYEVVIDGETTVIGGTSAVAPLFAALVARINQKLGKPVG
YLNPTLYQLPPEVFHDITEGNNDIANRARIYQAGPGWDPCTGLGSPIGIR
LLQALLP

Ligand information

>1gtj Chain 3 (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

IAF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1gtj The 1.4 A Crystal Structure of Kumamolysin. A Thermostable Serine-Carboxyl-Type Proteinase
Resolution	1.75 Å
Binding residue (original residue number in PDB)	E78 N102 S128 W129 G130 D164 D179 G276 T277 S278
Binding residue (residue number reindexed from 1)	E78 N102 S128 W129 G130 D164 D179 G276 T277 S278

Enzymatic activity

Catalytic site (original residue number in PDB)	D164
Catalytic site (residue number reindexed from 1)	D164
Enzyme Commision number	?

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1gtj, PDBe:1gtj, PDBj:1gtj
PDBsum	1gtj
PubMed	12057200
UniProt	Q8RR56

[Back to BioLiP]