Structure of PDB 7ung Chain 0 Binding Site BS01

Receptor Information
>7ung Chain 0 (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YSIVHRKCRSQFTDLNGSKRFGINTWHDESGIYANSDVKQKLYPLTSGPI
VP
Ligand information
>7ung Chain O (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANLAKRRHAELCRQKRVFNARNRII
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ung SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		S194 F197 I199
Binding residue
(residue number reindexed from 1)		S18 F21 I23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030317 flagellated sperm motility
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005879 axonemal microtubule
GO:0005886 plasma membrane
GO:0031514 motile cilium
GO:0036126 sperm flagellum
GO:0160111 axonemal A tubule inner sheath

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ung, PDBe:7ung, PDBj:7ung
PDBsum7ung
PubMed36191189
UniProtQ5VTT2|CFA95_HUMAN Cilia- and flagella-associated protein 95 (Gene Name=CFAP95)

[Back to BioLiP]