Structure of PDB 5mmi Chain 0 Binding Site BS01

Receptor Information
>5mmi Chain 0 (length=44) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSDIHPEFREDAKVYCNGELVMTTGGTQKDYTVEVWSGNHPFY
Ligand information
>5mmi Chain B (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uauucugguguccuaggcguagaggaaccacaccaauccaucccgaacuu
ggugguuaaacucuacugcggugacgauacuguaggggagguccugcgga
aaaauagcucgacgccaggau
.<<<<<<<<<<<....<<<<<<<<.....<<<<<<<............>>
>>>.>>....>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>.
......>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mmi The complete structure of the chloroplast 70S ribosome in complex with translation factor pY.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R37 K38 H42
Binding residue
(residue number reindexed from 1)		R1 K2 H6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0009507 chloroplast
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mmi, PDBe:5mmi, PDBj:5mmi
PDBsum5mmi
PubMed28007896
UniProtP82249|RK31_SPIOL Large ribosomal subunit protein bL31c (Gene Name=RPL31)

[Back to BioLiP]