ATGO result for protein E7CIP7

[Download result.zip for all prediction results]

Input Sequence

>E7CIP7 (382 residues)
MKIIVLLLLAVVLASADQTAPGTASRPILTASESNYFTTATYLQGWSPPSISTSKADYTV
GNGYNTIQAAVNAAINTGGTTRKYIKINAGTYQEVVYIPNTKVPLTIYGGGSSPSDTLIT
LNMPAQTTPSAYKSLVGSLFNSADPAYSMYNSCASKSGTIGTSCSTVFWVKAPAVQIVNL
SIENSAKNTGDQQAVALQTNSDQIQIHNARLLGHQDTLYAGSGSSSVERSYYTNTYIEGD
IDFVFGGGSAIFESCTFYVKADRRSDTAVVFAPDTDPHKMYGYFVYKSTITGDSAWSSSK
KAYLGRAWDSGVSSSSAYVPGTSPNGQLIIKESTIDGIINTSGPWTTATSGRTYSGNNAN
SRDLNNDNYNRFWEYNNSGNGA

Download query sequence

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901363	0.886	heterocyclic compound binding
GO:0097159	0.886	organic cyclic compound binding
GO:0003676	0.884	nucleic acid binding
GO:0003723	0.877	RNA binding
GO:0003729	0.874	mRNA binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.443	cellular process
GO:0008152	0.231	metabolic process
GO:0071704	0.221	organic substance metabolic process
GO:0044237	0.219	cellular metabolic process
GO:0044238	0.201	primary metabolic process
GO:0006807	0.194	nitrogen compound metabolic process
GO:0043170	0.183	macromolecule metabolic process
GO:0016070	0.152	RNA metabolic process
GO:0006396	0.130	RNA processing
GO:0050896	0.120	response to stimulus
GO:0032502	0.106	developmental process
GO:0044260	0.099	cellular macromolecule metabolic process
GO:0065007	0.096	biological regulation
GO:0050789	0.094	regulation of biological process
GO:0006364	0.094	rRNA processing
GO:0032501	0.089	multicellular organismal process
GO:0071840	0.082	cellular component organization or biogenesis

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0110165	0.904	cellular anatomical entity
GO:0005829	0.675	cytosol
GO:0043229	0.626	intracellular organelle
GO:0043226	0.618	organelle
GO:0032991	0.352	protein-containing complex
GO:0043228	0.336	non-membrane-bounded organelle
GO:0044391	0.332	ribosomal subunit
GO:0043232	0.316	intracellular non-membrane-bounded organelle
GO:0022626	0.209	cytosolic ribosome
GO:0043231	0.188	intracellular membrane-bounded organelle
GO:0022625	0.174	cytosolic large ribosomal subunit
GO:0022627	0.144	cytosolic small ribosomal subunit

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

[Download result.zip for all prediction results]

Reference:

Yi-Heng Zhu, Chengxin Zhang, Dong-Jun Yu, Yang Zhang. Integrating Self-Attention Transformer with Triplet Neural Networks for Protein Gene Ontology Prediction. Submitted, 2022.

[back to server]